Camelus ferus (Wild Bactrian camel): 102515788 Help Entry 102515788         CDS       T02979                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04061   Viral protein interaction with cytokine and cytokine receptor cfr04062   Chemokine signaling pathway cfr04621   NOD-like receptor signaling pathway cfr04657   IL-17 signaling pathway cfr04668   TNF signaling pathway cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr05135   Yersinia infection cfr05142   Chagas disease cfr05144   Malaria cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05168   Herpes simplex virus 1 infection cfr05171   Coronavirus disease - COVID-19 cfr05323   Rheumatoid arthritis cfr05417   Lipid and atherosclerosis cfr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102515788   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102515788    04061 Viral protein interaction with cytokine and cytokine receptor     102515788  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102515788    04657 IL-17 signaling pathway     102515788    04062 Chemokine signaling pathway     102515788  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102515788    05164 Influenza A     102515788    05168 Herpes simplex virus 1 infection     102515788    05163 Human cytomegalovirus infection     102515788   09171 Infectious disease: bacterial    05135 Yersinia infection     102515788   09174 Infectious disease: parasitic    05144 Malaria     102515788    05142 Chagas disease     102515788   09163 Immune disease    05323 Rheumatoid arthritis     102515788   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102515788    05418 Fluid shear stress and atherosclerosis     102515788   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102515788  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102515788    00536 Glycosaminoglycan binding proteins [BR:cfr00536]     102515788 Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Chemokines    102515788 Glycosaminoglycan binding proteins [BR:cfr00536]  Heparan sulfate / Heparin   Chemokines    102515788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Amastin GPR15L Motif Other DBs NCBI-GeneID:  102515788 NCBI-ProteinID:  XP_006185899 UniProt:  A0A8B6YGP9 LinkDB All DBs Position 16:44428686..44430656 Genome browser AA seq 99 aa AA seqDB search MKISAGLLCLLLTAATFSTQVLAQPDAINSPVTCCYTLTGKKIPMQKLMSYTRVTSSKCP KEAVIFKTTRAKEICADPEQKWVQDYMNYLDKKNQISKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaagatctctgcagggctcctgtgtctgctgctcacagcagccaccttcagcacccaa gtgctggctcagccagatgcaattaattcccccgtcacctgctgctatacactcaccggt aagaagatccccatgcagaagctgatgagctatacaagagtcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccacacgggccaaggagatctgtgctgaccccgagcag aagtgggtccaggattacatgaattacctggacaagaaaaaccaaatttcaaagccttga

DBGET integrated database retrieval system