Macaca mulatta (rhesus monkey): 574138 Help Entry 574138            CDS       T01028                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2 precursor   KO K14624   C-C motif chemokine 2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04668   TNF signaling pathway mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc05135   Yersinia infection mcc05142   Chagas disease mcc05144   Malaria mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05168   Herpes simplex virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     574138 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     574138 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     574138 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     574138 (CCL2)    04657 IL-17 signaling pathway     574138 (CCL2)    04062 Chemokine signaling pathway     574138 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     574138 (CCL2)    05164 Influenza A     574138 (CCL2)    05168 Herpes simplex virus 1 infection     574138 (CCL2)    05163 Human cytomegalovirus infection     574138 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     574138 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     574138 (CCL2)    05142 Chagas disease     574138 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     574138 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     574138 (CCL2)    05418 Fluid shear stress and atherosclerosis     574138 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     574138 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574138 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     574138 (CCL2) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    574138 (CCL2) Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Chemokines    574138 (CCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  574138 NCBI-ProteinID:  NP_001027993 Ensembl:  ENSMMUG00000000288 UniProt:  P61275 Q71ME7 A0A8J8YA47 LinkDB All DBs Position 16:30638331..30639783 Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLIAATFSPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQIQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctctgcagcacttctgtgcctgctgctcatagcagccaccttcagcccccag gggctcgctcagccagatgcaatcaatgcccccgtcacttgctgctataacttcaccaat aggaagatctcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag aagtgggttcaggattccatggaccacctggacaagcaaatccaaactccgaagccttga

DBGET integrated database retrieval system