Mus pahari (shrew mouse): 110332475 Help Entry 110332475         CDS       T05929                                  Name (RefSeq) C-C motif chemokine 12   KO K14624   C-C motif chemokine 2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04668   TNF signaling pathway mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah05135   Yersinia infection mpah05142   Chagas disease mpah05144   Malaria mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05168   Herpes simplex virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05323   Rheumatoid arthritis mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     110332475   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110332475    04061 Viral protein interaction with cytokine and cytokine receptor     110332475  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110332475    04657 IL-17 signaling pathway     110332475    04062 Chemokine signaling pathway     110332475  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110332475    05164 Influenza A     110332475    05168 Herpes simplex virus 1 infection     110332475    05163 Human cytomegalovirus infection     110332475   09171 Infectious disease: bacterial    05135 Yersinia infection     110332475   09174 Infectious disease: parasitic    05144 Malaria     110332475    05142 Chagas disease     110332475   09163 Immune disease    05323 Rheumatoid arthritis     110332475   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110332475    05418 Fluid shear stress and atherosclerosis     110332475   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110332475  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110332475    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110332475 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110332475 Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Chemokines    110332475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  110332475 NCBI-ProteinID:  XP_021069385 LinkDB All DBs Position 14:49851965..49853525 Genome browser AA seq 98 aa AA seqDB search MKIPTLLCLLLIAATISPQVLAGPDAVFTPVTCCYNVVKQKIHVRKLKSYRRITSSQCPR EAVIFRTTLDKEICADPKEKWVKNSINHLDKKSQTQHP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagattcctacacttctatgcctcctgctcatagctgccaccatcagcccacaggta ttggctggaccagatgcggtgttcaccccagtcacctgctgttataatgtcgttaagcag aagatccatgtccggaagctgaagagttacaggagaatcacaagcagccagtgtccccgg gaagctgtgatcttcaggaccacactggataaggagatctgtgctgaccccaaggagaag tgggtaaagaattccataaaccacttggataagaagtctcaaactcagcatccttga

DBGET integrated database retrieval system