Sciurus carolinensis (gray squirrel): 124980085 Help Entry 124980085         CDS       T08117                                  Name (RefSeq) C-C motif chemokine 2-like   KO K14624   C-C motif chemokine 2 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04061   Viral protein interaction with cytokine and cytokine receptor ncar04062   Chemokine signaling pathway ncar04621   NOD-like receptor signaling pathway ncar04657   IL-17 signaling pathway ncar04668   TNF signaling pathway ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar05135   Yersinia infection ncar05142   Chagas disease ncar05144   Malaria ncar05163   Human cytomegalovirus infection ncar05164   Influenza A ncar05168   Herpes simplex virus 1 infection ncar05171   Coronavirus disease - COVID-19 ncar05323   Rheumatoid arthritis ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     124980085   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124980085    04061 Viral protein interaction with cytokine and cytokine receptor     124980085  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124980085    04657 IL-17 signaling pathway     124980085    04062 Chemokine signaling pathway     124980085  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     124980085    05164 Influenza A     124980085    05168 Herpes simplex virus 1 infection     124980085    05163 Human cytomegalovirus infection     124980085   09171 Infectious disease: bacterial    05135 Yersinia infection     124980085   09174 Infectious disease: parasitic    05144 Malaria     124980085    05142 Chagas disease     124980085   09163 Immune disease    05323 Rheumatoid arthritis     124980085   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124980085    05418 Fluid shear stress and atherosclerosis     124980085   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     124980085  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124980085    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124980085 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Chemokines    124980085 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Chemokines    124980085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  124980085 NCBI-ProteinID:  XP_047401226 LinkDB All DBs Position 3:68448491..68450308 Genome browser AA seq 136 aa AA seqDB search MKVSAVLLCLMLTVAAFSSLVLAQPDAVNSPVTCCYTLTSKKIPLKRLMSYREVTSSKCP KEAVIFTTVLNKEICADきゃどPMQKWVQEYLATMNQKTGLDQNPAALGTATPANTNFTTQEPAA SSSTTSFLSKNSKTSI NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagtccttctgtgcctgatgctcacagtggccgccttcagcagcctc gtgcttgctcagccagatgcagtgaattccccagtcacctgctgctacacactcaccagc aagaagatccccttgaagaggctgatgagctatagggaagtcaccagcagcaagtgtccc aaggaagccgtgattttcacaaccgtactgaacaaagagatctgcgctgaccccatgcag aagtgggtccaggaataccttgccacgatgaaccagaaaactggtctggaccagaaccca gctgctctaggaactgcaactcctgcgaacactaacttcaccacccaagaacctgcagcc agttcatctaccacaagctttctctccaaaaactctaaaactagtatatga

DBGET integrated database retrieval system