Ursus americanus (American black bear): 123777113 Help Entry 123777113         CDS       T07931                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway uar04621   NOD-like receptor signaling pathway uar04657   IL-17 signaling pathway uar04668   TNF signaling pathway uar04933   AGE-RAGE signaling pathway in diabetic complications uar05135   Yersinia infection uar05142   Chagas disease uar05144   Malaria uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05168   Herpes simplex virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05323   Rheumatoid arthritis uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     123777113   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123777113    04061 Viral protein interaction with cytokine and cytokine receptor     123777113  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     123777113    04657 IL-17 signaling pathway     123777113    04062 Chemokine signaling pathway     123777113  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123777113    05164 Influenza A     123777113    05168 Herpes simplex virus 1 infection     123777113    05163 Human cytomegalovirus infection     123777113   09171 Infectious disease: bacterial    05135 Yersinia infection     123777113   09174 Infectious disease: parasitic    05144 Malaria     123777113    05142 Chagas disease     123777113   09163 Immune disease    05323 Rheumatoid arthritis     123777113   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123777113    05418 Fluid shear stress and atherosclerosis     123777113   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     123777113  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123777113    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123777113 Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123777113 Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Chemokines    123777113 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123777113 NCBI-ProteinID:  XP_045629547 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MKVSATLLCLLLTAAAFSLQVLAQPDAISSPVTCCYTLTNKKISMQRLGSYKRVTSSKCP KEAVIFKTILNKEICADきゃどPNQKWVQDSMAHLDKKTQTQTAKP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgccacacttctctgcctgctgctcacagccgctgccttcagcctccag gtgctcgcccagccagatgcaattagttctccagtcacctgctgctatacactcaccaat aagaagatctcaatgcagaggctggggagctataaaagagtcaccagcagcaagtgtccc aaagaggctgtgatcttcaagaccatccttaacaaggagatctgtgctgaccccaaccag aagtgggtccaggattccatggcacacctggataagaaaacccaaacccaaactgcaaag ccatga

DBGET integrated database retrieval system