(Translated by https://www.hiragana.jp/)
STX5 - Wikipedia Idi na sadržaj

STX5

S Wikipedije, slobodne enciklopedije
STX5
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3EFO

Identifikatori
AliasiSTX5
Vanjski ID-jeviOMIM: 603189 MGI: 1928483 HomoloGene: 2381 GeneCards: STX5
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za STX5
Genomska lokacija za STX5
Bend11q12.3Početak62,806,860 bp[1]
Kraj62,832,051 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za STX5
Genomska lokacija za STX5
Bend19|19 APočetak8,718,777 bp[2]
Kraj8,733,433 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein N-terminus binding
GO:0001948, GO:0016582 vezivanje za proteine
SNARE binding
SNAP receptor activity
cadherin binding
Ćelijska komponenta integral component of membrane
Vezikula
endoplasmic reticulum membrane
membrana
Endoplazmatski retikulum
ER to Golgi transport vesicle membrane
SNARE complex
endoplasmic reticulum-Golgi intermediate compartment membrane
Golđijev aparat
citosol
Golđijeva membrana
Endomembranski sistem
Biološki proces GO:1903364 positive regulation of protein catabolic process
vesicle fusion with Golgi apparatus
early endosome to Golgi transport
vesicle docking
COPII vesicle coating
regulation of Golgi organization
retrograde transport, endosome to Golgi
Golgi disassembly
Fuzija vezikula
vesicle-mediated transport
intracellular protein transport
endoplasmic reticulum to Golgi vesicle-mediated transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001244666
NM_003164
NM_001330294

NM_001167799
NM_019829

RefSeq (bjelančevina)

NP_001231595
NP_001317223
NP_003155

NP_001161271
NP_062803

Lokacija (UCSC)Chr 11: 62.81 – 62.83 MbChr 19: 8.72 – 8.73 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin-5 jest protein koji je kod ljudi kodiran genom STX5 sa hromosoma 11.[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 355 aminokiselina, a molekulska težina 39.673 Da.

1020304050
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPP
PPDTMSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKR
IGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQI
AQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTEN
LKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDS
RTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIF
VVFLA

Interakcije[uredi | uredi izvor]

Pokazalo se da STX5 ima interakcije sa:

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000162236 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000010110 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ravichandran V, Roche PA (Apr 1997). "Cloning and identification of human syntaxin 5 as a synaptobrevin/VAMP binding protein". Journal of Molecular Neuroscience. 8 (2): 159–61. doi:10.1007/BF02736780. PMID 9188044. S2CID 8942580.
  6. ^ Parlati F, Varlamov O, Paz K, McNew JA, Hurtado D, Söllner TH, Rothman JE (Apr 2002). "Distinct SNARE complexes mediating membrane fusion in Golgi transport based on combinatorial specificity". Proceedings of the National Academy of Sciences of the United States of America. 99 (8): 5424–9. doi:10.1073/pnas.082100899. PMC 122785. PMID 11959998.
  7. ^ "Entrez Gene: STX5 syntaxin 5".
  8. ^ a b c d Shorter J, Beard MB, Seemann J, Dirac-Svejstrup AB, Warren G (Apr 2002). "Sequential tethering of Golgins and catalysis of SNAREpin assembly by the vesicle-tethering protein p115". The Journal of Cell Biology. 157 (1): 45–62. doi:10.1083/jcb.200112127. PMC 2173270. PMID 11927603.
  9. ^ Xu Y, Martin S, James DE, Hong W (Oct 2002). "GS15 forms a SNARE complex with syntaxin 5, GS28, and Ykt6 and is implicated in traffic in the early cisternae of the Golgi apparatus". Molecular Biology of the Cell. 13 (10): 3493–507. doi:10.1091/mbc.E02-01-0004. PMC 129961. PMID 12388752.
  10. ^ a b Hay JC, Chao DS, Kuo CS, Scheller RH (Apr 1997). "Protein interactions regulating vesicle transport between the endoplasmic reticulum and Golgi apparatus in mammalian cells". Cell. 89 (1): 149–58. doi:10.1016/s0092-8674(00)80191-9. PMID 9094723. S2CID 8682509.
  11. ^ a b Hay JC, Klumperman J, Oorschot V, Steegmaier M, Kuo CS, Scheller RH (Jun 1998). "Localization, dynamics, and protein interactions reveal distinct roles for ER and Golgi SNAREs". The Journal of Cell Biology. 141 (7): 1489–502. doi:10.1083/jcb.141.7.1489. PMC 2133002. PMID 9647643.
  12. ^ Subramaniam VN, Loh E, Hong W (Oct 1997). "N-Ethylmaleimide-sensitive factor (NSF) and alpha-soluble NSF attachment proteins (SNAP) mediate dissociation of GS28-syntaxin 5 Golgi SNAP receptors (SNARE) complex". The Journal of Biological Chemistry. 272 (41): 25441–4. doi:10.1074/jbc.272.41.25441. PMID 9325254.
  13. ^ Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M (Oct 2005). "Towards a proteome-scale map of the human protein-protein interaction network". Nature. 437 (7062): 1173–8. doi:10.1038/nature04209. PMID 16189514. S2CID 4427026.
  14. ^ Rabouille C, Kondo H, Newman R, Hui N, Freemont P, Warren G (Mar 1998). "Syntaxin 5 is a common component of the NSF- and p97-mediated reassembly pathways of Golgi cisternae from mitotic Golgi fragments in vitro". Cell. 92 (5): 603–10. doi:10.1016/s0092-8674(00)81128-9. PMID 9506515. S2CID 17285800.
  15. ^ Allan BB, Moyer BD, Balch WE (Jul 2000). "Rab1 recruitment of p115 into a cis-SNARE complex: programming budding COPII vesicles for fusion". Science. 289 (5478): 444–8. doi:10.1126/science.289.5478.444. PMID 10903204.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]