(Translated by https://www.hiragana.jp/)
TDGF1 - Wikipedia Idi na sadržaj

TDGF1

S Wikipedije, slobodne enciklopedije
TDGF1
Identifikatori
AliasiTDGF1
Vanjski ID-jeviMGI: 98658 HomoloGene: 2416 GeneCards: TDGF1
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za TDGF1
Genomska lokacija za TDGF1
Bend3p21.31Početak46,574,534 bp[1]
Kraj46,582,457 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za TDGF1
Genomska lokacija za TDGF1
Bend9 F2|9 60.79 cMPočetak110,768,671 bp[2]
Kraj110,775,226 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
growth factor activity
signaling receptor binding
nodal binding
activin receptor binding
Ćelijska komponenta membrana
ćelijska membrana
cell surface
apical plasma membrane
Lipidni splav
anchored component of membrane
extrinsic component of plasma membrane
Vanćelijsko
extracellular region
Biološki proces Ćelijska diferencijacija
cellular response to interleukin-6
epidermal growth factor receptor signaling pathway
somatic stem cell population maintenance
positive regulation of cell migration
cellular response to hepatocyte growth factor stimulus
cellular response to tumor necrosis factor
negative regulation of apoptotic process
cellular response to fibroblast growth factor stimulus
morphogenesis of a branching structure
cell migration involved in sprouting angiogenesis
mammary gland development
positive regulation of endothelial cell migration
cellular response to epidermal growth factor stimulus
heart development
regulation of signal transduction
GO:0035404 peptidyl-serine phosphorylation
positive regulation of cell population proliferation
positive regulation of peptidyl-tyrosine phosphorylation
cellular response to interferon-gamma
anterior/posterior axis specification, embryo
regulation of signaling receptor activity
embryo development ending in birth or egg hatching
determination of left/right symmetry
anterior/posterior pattern specification
BMP signaling pathway
nodal signaling pathway
GO:1903374 anatomical structure development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003212
NM_001174136

NM_011562

RefSeq (bjelančevina)

NP_001167607
NP_003203

n/a

Lokacija (UCSC)Chr 3: 46.57 – 46.58 MbChr 9: 110.77 – 110.78 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transmembranski protein 158 jest protein koji je kod ljudi kodiran genom TMEM158 sa hromosoma 3.[5][6][7]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 300 aminokiselina, а molekulska težina 30.404 Da.[8].

1020304050
MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRL
LASAAPGPPERPGPEEAAAAAAPCNISVQRQMLSSLLVRWGRPRGFQCDL
LLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVR
GRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCL
DFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAG
FLPNGMEQRRTTASTTAATPAAVPAGTTAAAAAAAAAAAAAAVTSGVATK

Funkcija

[uredi | uredi izvor]

Kodirani protein je sličan pacovskom receptoru ćelijske površine za koji je predloženo da funkcionira u neuronskom putu preživljavanja[7]

Konstitutivna aktivacija Ras puta pokreće ireverzibilno zaustavljanje proliferacije koje podsjeća na replikativnu senescenciju. Transkripcija ovog gena je pojačana kao odgovor na aktivaciju Ras puta, ali ne pod drugim uvjetima koji induciraju starenje .

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000241186 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000032494 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Hama T, Maruyama M, Katoh-Semba R, Takizawa M, Iwashima M, Nara K (Aug 2001). "Identification and molecular cloning of a novel brain-specific receptor protein that binds to brain injury-derived neurotrophic peptide. Possible role for neuronal survival". J Biol Chem. 276 (34): 31929–35. doi:10.1074/jbc.M100617200. PMID 11399754.
  6. ^ Barradas M, Gonos ES, Zebedee Z, Kolettas E, Petropoulou C, Delgado MD, Leon J, Hara E, Serrano M (Feb 2002). "Identification of a candidate tumor-suppressor gene specifically activated during Ras-induced senescence". Exp Cell Res. 273 (2): 127–37. doi:10.1006/excr.2001.5434. PMID 11822868.
  7. ^ a b "Entrez Gene: TMEM158 transmembrane protein 158".
  8. ^ "UniProt, Q8WZ71" (jezik: eng). Pristupljeno 6. 11. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

[uredi | uredi izvor]